PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G26350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family HB-PHD
Protein Properties Length: 1004aa    MW: 110219 Da    PI: 4.8709
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G26350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.28.8e-11809855652
                      S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
         Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       f ++  + L+ +F++++yps++ +e LA++lgLt +qV+ WF   R
  LPERR01G26350.1 809 HFGPTINQKLKVYFKEDPYPSRAIKENLAQELGLTFNQVSKWFSSTR 855
                      566777789**********************************8776 PP

2PHD41.23.9e-14499554151
                      SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C++Cg+   + +++++lCdg C++ fH+ C++++l  e++p g   wlC+ C++k
  LPERR01G26350.1 499 FCAICGSkdVTLKNDIILCDGiCDRGFHQFCINPPLFAEDIPPGdeGWLCPACDCK 554
                      7******64445********88********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF495037.22E-2624129IPR008972Cupredoxin
Gene3DG3DSA:2.60.40.4201.1E-2724133IPR008972Cupredoxin
PROSITE profilePS5148536.92925130IPR003245Phytocyanin domain
CDDcd110192.42E-4925129No hitNo description
PfamPF022988.4E-1335122IPR003245Phytocyanin domain
ProDomPD0031228.0E-2869132IPR003245Phytocyanin domain
SuperFamilySSF579031.79E-14489557IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.7E-13496553IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.003497554IPR019787Zinc finger, PHD-finger
PfamPF006282.1E-11499554IPR019787Zinc finger, PHD-finger
CDDcd155042.97E-25499551No hitNo description
SMARTSM002496.4E-11499552IPR001965Zinc finger, PHD-type
PROSITE patternPS013590500551IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.248801861IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-11801855IPR009057Homeodomain-like
SuperFamilySSF466892.22E-10801859IPR009057Homeodomain-like
SMARTSM003891.6E-11804865IPR001356Homeobox domain
CDDcd000863.26E-12806859No hitNo description
PfamPF000463.2E-8809855IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0009055Molecular Functionelectron carrier activity
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MEAPCAAWFM AVLGFAAVVS SSEAYVFYAG GRDGWVVDPS ESFNHWAERN RFQVNDTIVF  60
MHDDEVAGSV LLVTEQDFDA CNTGNPVQRL DDVAAGRSVF RFDRSGPFFF ISGDEDRCQK  120
GQKLYIIVMA VRQMPPSEAP EPAAAGPGSS ESSAGPAFPP TGDAMPPSPF WASPPEYAQA  180
PGRSSLDDFD GEMSRSSTLG APPPMSGAAG LDEVVAGLHH FNRNPIRANS ISGPNRSHVP  240
VERGPSVAVI YMDKETTSDL VLDNGNFGRN AGSAQEPLTA KGKTSGVRNR YKQTDKGGRK  300
GTQISPSKKY ALRSSHSSVR VLRSASKKKN ETPKAPVNDN TAVQQAAKKR KRNKPLKPVH  360
SSLKVLPSAS KRKTKARNEL VNEDVGVQLA VKKRKVGRPP KGETPKDDYL TIRKRVRYIL  420
NRMNYEQSLI QAYASEGWKG QSLEKIRPEK ELERAKVEIL RCKLRIREAF QNLDSLLSEG  480
KLEESLFDSA GEIDSEDIFC AICGSKDVTL KNDIILCDGI CDRGFHQFCI NPPLFAEDIP  540
PGDEGWLCPA CDCKIDCIDV LNELQEVKLS IHDSWEKVFP EAASFANGSK QINASDLPSD  600
DSADNDYNPA LTQGHSVDEE KSSGQDEGEK LDSDDSSEDS ESYENEKSKT SKNGRTVDDL  660
GLPSEDSEDD DFDPEGPDSD KDQNDDPNSD QSDESDFTSD SDDFCGEIAK SCVQDEISGP  720
SSSQIRTVNH ANESAFDSEP NAENLNLAFM ETELEQDMVL PVSSKRQVEA FGKASSDSSD  780
EEEWSGNISE QQTEVLCSNS NGSTSRKRHF GPTINQKLKV YFKEDPYPSR AIKENLAQEL  840
GLTFNQVSKW FSSTRHYSRV AATKKENNLE NHTAEHNNSN TVDTTELRGS NEMMMGKVSV  900
HRNDTVERTG QNNLNESIPL RQDTSCGQGV VVTPTGVNQN CHIVSKEIGS PKCGTRENQG  960
NDSTSNIGTP KVKSAEKTSP GVEHADEARR KAIQRELRKM KTGK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1347354KKRKRNKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0813400.0AB081340.1 Oryza sativa Japonica Group HAZ1 mRNA for PHD-finger family homeodomain protein, complete cds.
GenBankAK1014280.0AK101428.1 Oryza sativa Japonica Group cDNA clone:J033038H23, full insert sequence.
GenBankAK1213140.0AK121314.1 Oryza sativa Japonica Group cDNA clone:J023113A13, full insert sequence.
GenBankFJ9401970.0FJ940197.1 Oryza sativa Japonica Group clone KCS150D11 PHD-finger family homeodomain protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643653.10.0PREDICTED: homeobox protein HOX1A isoform X1
RefseqXP_006643654.10.0PREDICTED: homeobox protein HOX1A isoform X1
TrEMBLA0A0D9V5L40.0A0A0D9V5L4_9ORYZ; Uncharacterized protein
STRINGOB01G10540.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.18e-79Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain